PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_21467
Common NameKK1_022101
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family LBD
Protein Properties Length: 197aa    MW: 21495.5 Da    PI: 5.1995
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_21467genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.45.1e-43291281100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r da++s+vyeA ar+rdPvyG++g i +lq+q+++l+a+la+
  C.cajan_21467  29 PCAACKILRRRCADKCVLAPYFPPTEPSKFTIAHRVFGASNIIKFLQELPESQRADAVTSMVYEASARIRDPVYGCAGAICQLQKQVNELQAQLAK 124
                    7*********************************************************************************************** PP

         DUF260  97 lkee 100
                    +++e
  C.cajan_21467 125 AQAE 128
                    9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.38928129IPR004883Lateral organ boundaries, LOB
PfamPF031956.5E-4329126IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MESSDTCSAP LSHSPTSSSS SPPTVVMSPC AACKILRRRC ADKCVLAPYF PPTEPSKFTI  60
AHRVFGASNI IKFLQELPES QRADAVTSMV YEASARIRDP VYGCAGAICQ LQKQVNELQA  120
QLAKAQAELV NMQFQQANLV ALICMEMAQS PQQESPQQSV DNIVISTPPH SGGYQSGMNF  180
LIEENTSLNS LWEPLWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0971750.0BT097175.1 Soybean clone JCVI-FLGm-21N19 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003538040.11e-112PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR03e-77LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A151TN381e-145A0A151TN38_CAJCA; LOB domain-containing protein 1
STRINGGLYMA11G15810.11e-111(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-62LOB domain-containing protein 1